PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016442573.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 291aa    MW: 32639.4 Da    PI: 10.1824
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016442573.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.41.2e-1182126347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rW+++E+  ++ + ++lG g+W+ Ia+++   Rt  q+ s+ qky
   XP_016442573.1  82 RWSEDEHRAFLIGLEKLGRGNWAGIAKEFVPSRTHTQVASHAQKY 126
                      9*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.03475131IPR017930Myb domain
SuperFamilySSF466894.56E-1578131IPR009057Homeodomain-like
TIGRFAMsTIGR015577.3E-1578129IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.0E-1079126IPR009057Homeodomain-like
SMARTSM007171.9E-879129IPR001005SANT/Myb domain
CDDcd001675.78E-882127No hitNo description
PfamPF002492.3E-982126IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MDSYVHAWPF SCAQFAKREY VMRMAKEIHS ERRGEISRTK KVGSSSNSIK LFGVVITTNF  60
GSSSSRSNTG RRNNNNSNKG TRWSEDEHRA FLIGLEKLGR GNWAGIAKEF VPSRTHTQVA  120
SHAQKYFERL EAEKDNKRAV IKRQKFSVFD INLAEESCRS SSPTNQPVSE EASSSKRVVV  180
PVTKDKEPLN QETPISPMPI SYRVPGFPPV PMAYNKNLTI SSNNQGPHVY TASWVPNIPF  240
NGNYAYFPKS YYQFANISAH NFASSSTNAT PDQRVSSQSD RASVDNLDLT I
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016442573.10.0PREDICTED: myb-like protein J
TrEMBLM1DC732e-48M1DC73_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000866415e-48(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13677916
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.14e-22MYB_related family protein